PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00003008-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family NF-YB
Protein Properties Length: 228aa    MW: 26174.5 Da    PI: 6.9331
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00003008-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.73.9e-5476172197
             NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       vreqdrf+Pianv+rim+kvlP++akis+daket+qecvsefisf+tsea+d+cq+e+rkti+++d+lwa+ +lGf++y++pl++yl++yr++
  PSME_00003008-RA  76 VREQDRFMPIANVIRIMRKVLPTHAKISDDAKETIQECVSEFISFITSEANDRCQKEQRKTITAEDVLWAMNKLGFDNYMDPLTLYLQRYRDI 168
                       69******************************************************************************************* PP

             NF-YB  94 egek 97 
                       eg++
  PSME_00003008-RA 169 EGDH 172
                       *996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.5E-5171181IPR009072Histone-fold
SuperFamilySSF471131.34E-3979190IPR009072Histone-fold
PfamPF008081.5E-2682146IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.2E-17110128No hitNo description
PROSITE patternPS006850113129IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.2E-17129147No hitNo description
PRINTSPR006154.2E-17148166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MLSSSIFFIN FKDSKILLSW YKMSPCMYAS YLHCRHLSPL CHLKQAQSTA SMAEDASPTS  60
QDNSTSEDGD RENCAVREQD RFMPIANVIR IMRKVLPTHA KISDDAKETI QECVSEFISF  120
ITSEANDRCQ KEQRKTITAE DVLWAMNKLG FDNYMDPLTL YLQRYRDIEG DHRGSIRGDT  180
LAKKDATSLT FSTGFQMNHQ GHYGTRLGYY KDSMTNANIH FDPYAPYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A6e-4077167494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-4077167494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857806.22e-76PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ84W666e-63NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLE5GAV81e-101E5GAV8_PINCO; CCAAT-box binding factor HAP3-like protein
STRINGEFJ121452e-70(Selaginella moellendorffii)
STRINGEFJ293872e-70(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-64nuclear factor Y, subunit B6